SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096N0S7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096N0S7
Domain Number 1 Region: 644-754
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000177
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 
Domain Number 2 Region: 374-495
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000427
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096N0S7
Sequence length 1077
Comment (tr|A0A096N0S7|A0A096N0S7_PAPAN) Regulator of G protein signaling like 1 {ECO:0000313|Ensembl:ENSPANP00000005866} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=RGSL1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MSSAEIIGSTNLIILLEDEIFADFFNTFLSLPVFGQTPFYTVENSQWSLWPEIPCNLIAK
YKGLLTWLEKHRLPFFCKTNLCFHYILCQELISFIKSPEGGEELVDFWILAEKILSIDEM
DLEVRDYYLSLLLMLRATHLQEGSRVVTLCNMNIKSLLSISIWHPNQSTTRREILSHMQK
VALFKLQSYWLPNFYTHTKMTMAKEEACHGLMQEYETRLYSVCYTHVGGLPLNMSIQKCH
HSHKQYSSRKAKRKMWQLVDPDSWSLEMDLKPDTIGTPLQETCPQEKVIIQMPFLKMASS
KETRISSLEKDMHYAKKSSMKNKAKSHLHMEGLFETKVSTHLRTVTPIIHHSSKMTIQKA
IKQSFSLGYIHLALCADSYAGNPFRDHLKKLNLKVEIQLLDLWQDLHHFLSVLVNNKNNG
NAIFRHLLGDRICELYLNEQIGPRLPLKSQTIQGLKELLPSGDVIPWIPKAQKEICKMLS
PWYDEFLDEEDYWFLLFTTQNKFISSRQHKREFIGKEENILLYKRIQHSLELSQALADMK
EMDYMQWRKIATEDLKQGGSLQVELTSPVFLTDVTKMSFEELCYKNPKIAVEKISDDYKV
YCEKAPKIDFKVEIIKEPKIFSRSNRKMSFLKKALVRKPSMRPRNLTEVLLNTQHLEFFR
EFLKERKAESPLQFLIAVQKISMETSEKICKSLIENVIKTFFQGQLSPEEMLQCDAPIIK
EITPTRHVTTTTLLILQGYIMKSIEEKWFKDYQDLFPPRPEEVEVQSEVQVSSRKPSKIV
STYLQESQKKGWLRMISFIRSFCKYRRFMLNPNKRQEFEDYLRQEMQNSKENFTTSHNTS
GRSAPPSTNVRSADQENGDTTLVKRRVFGHRIITVNFVINDLYFFSEMEKFNNLVSSAHM
LQVNRAYNENDVILMRSKMNIIQKLFLNSDIPPKLRVNVSESQKDAILAAITEGYLDRSV
FHGAIMSVFPVIMYFWKRFCFWKATRSYLQYRGKKFKDRKSPPKSTEKYPFSSGGDNAIL
RFTLLRGIEWLQPQREAISSVQNSSSSNLTQPRLVVSALQLHPVQGQKLSYTKKEKK
Download sequence
Identical sequences A0A096N0S7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]