SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096N4F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096N4F1
Domain Number 1 Region: 63-171
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 3.6e-28
Family Steroid-binding domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096N4F1
Sequence length 195
Comment (tr|A0A096N4F1|A0A096N4F1_PAPAN) Progesterone receptor membrane component 1 {ECO:0000313|Ensembl:ENSPANP00000007267} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=PGRMC1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAAEDVVATGADPSELESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDD
EPPPLPRLKRRDFTPAELRLFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRD
ASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVY
SDEEEPKDESARKND
Download sequence
Identical sequences A0A096N4F1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]