SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096N7H9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096N7H9
Domain Number 1 Region: 321-450
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.01e-43
Family Regulator of G-protein signaling, RGS 0.000022
Further Details:      
 
Domain Number 2 Region: 18-121
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-32
Family DEP domain 0.014
Further Details:      
 
Domain Number 3 Region: 248-310
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 3.79e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096N7H9
Sequence length 477
Comment (tr|A0A096N7H9|A0A096N7H9_PAPAN) Regulator of G protein signaling 7 {ECO:0000313|Ensembl:ENSPANP00000008504} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=RGS7 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGS
DIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNC
WEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKK
RDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSH
SPTHTPTPETKPPTEDELQQQIKYWQIQLDRHRLKMSKVADSLLGYTEQYLEYDPFLLPP
DPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENL
RFWLAVEDLKKRPIKEVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE
DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKGRNIPIFPCHKNCTPTLRASTNLL
Download sequence
Identical sequences A0A096N7H9 A0A2K5HV10 A0A2K5UU01 A0A2K6RIR5
XP_005539733.1.63531 XP_007988122.1.81039 XP_010382993.1.97406 XP_011727761.1.29376 XP_011727762.1.29376 XP_011811071.1.43180 XP_011891649.1.92194 XP_011891650.1.92194 XP_011891652.1.92194 XP_014982622.1.72884 XP_017703302.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]