SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NJT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NJT3
Domain Number 1 Region: 55-837
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.45e-284
Family Motor proteins 2.29e-16
Further Details:      
 
Domain Number 2 Region: 838-963
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.49e-22
Family Myosin rod fragments 0.00034
Further Details:      
 
Domain Number 3 Region: 958-1073
Classification Level Classification E-value
Superfamily Myosin rod fragments 6.71e-21
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 4 Region: 1244-1351
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.2e-17
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number 5 Region: 1516-1629
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000192
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 6 Region: 1062-1152
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000235
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 7 Region: 1351-1452
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000131
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 8 Region: 1762-1862
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000612
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096NJT3
Sequence length 1962
Comment (tr|A0A096NJT3|A0A096NJT3_PAPAN) Myosin heavy chain 9 {ECO:0000313|Ensembl:ENSPANP00000013237} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=MYH9 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDFLASLCRGESGAGKTE
NTKKVIQYLAYVASSHKSKKDQVSAVGELERQLLQANPILEAFGNAKTVKNDNSSRFGKF
IRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYN
KYRFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKER
NTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALA
KATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQ
LFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPVSPPGILALLDEECWFPKAT
DKSFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIAT
LLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLM
ATLRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFR
QRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLK
ITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLL
QVSRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAE
AEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQTEKKKMQQNIQELEEQLEEEESA
RQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSL
AKLKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQL
AKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLG
EELEALKTELEDTLDTTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAV
EELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQ
VKFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQ
EENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVG
CLETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACN
LEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERL
NKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRL
EVNLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMD
LKDLEAHIDSANKNREEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSM
EAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEEL
EEEQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEME
GTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNA
EQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLK
NKLRRGDLPFVMPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Download sequence
Identical sequences A0A096NJT3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]