SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NMX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NMX7
Domain Number 1 Region: 127-180
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 7.85e-21
Family AN1-like Zinc finger 0.00013
Further Details:      
 
Domain Number 2 Region: 13-63
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000134
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096NMX7
Sequence length 204
Comment (tr|A0A096NMX7|A0A096NMX7_PAPAN) Fumarylacetoacetate hydrolase {ECO:0000313|Ensembl:ENSPANP00000014337} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=FAH OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSE
SLPVQCTDGSVPEAQSTLDSTSSSVQPSSVSNQSLLSESVASSQLDSTSVDKAVPETEDL
QASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHN
YDCPLLLLTIQNCVGDHNQWSKTR
Download sequence
Identical sequences A0A096NMX7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]