SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NVT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NVT0
Domain Number 1 Region: 36-140
Classification Level Classification E-value
Superfamily Cystatin/monellin 1.29e-26
Family Cystatins 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096NVT0
Sequence length 142
Comment (tr|A0A096NVT0|A0A096NVT0_PAPAN) Cystatin {ECO:0000256|RuleBase:RU362130} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=CST8 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MPRCRWLSLLLLTIPLALVARKDSNKNEMVVLRKLKPVNASNANVKQCLWFAMQEYNEES
EDKYVFLVVKTLQAQLQVTNRLEYLIDVEIARSDCRKPFSTNEICAIQENPKLKKKLSCS
FLVGALPWNGEFTVMEKKCEDA
Download sequence
Identical sequences A0A096NVT0
ENSPANP00000017155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]