SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NWS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NWS0
Domain Number 1 Region: 76-203
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.93e-47
Family Regulator of G-protein signaling, RGS 0.000000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096NWS0
Sequence length 235
Comment (tr|A0A096NWS0|A0A096NWS0_PAPAN) Regulator of G protein signaling 18 {ECO:0000313|Ensembl:ENSPANP00000017502} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=RGS18 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHED
TCSSRSGHLAKETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACE
DFKKSKGPQQIHLKAKAIYEKFIKTDAPKEVNLDFHTKEVITKSITQPTLHSFDAAQSRV
YQLMEQDSYTRFLKSDIYLDLIEGRPQRPTNLRRRSRSFTCNEFQDVQSDAAIWL
Download sequence
Identical sequences A0A096NWS0
ENSPANP00000017502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]