SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096NXV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096NXV4
Domain Number 1 Region: 282-401
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-25
Family Regulator of G-protein signaling, RGS 0.0024
Further Details:      
 
Domain Number 2 Region: 493-626
Classification Level Classification E-value
Superfamily PX domain 4.06e-22
Family PX domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096NXV4
Sequence length 840
Comment (tr|A0A096NXV4|A0A096NXV4_PAPAN) Sorting nexin 25 {ECO:0000313|Ensembl:ENSPANP00000017909} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=SNX25 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MDKALKEVFDYSYRDYILSWYGNLSRDEGQLYHLLLEDFWEIARQLHHRLSHVDVVKVVC
NDVVRTLLTHFCDLKAANARHEEQPRPFVLHACLRNSDDEVRFLQTCSRVLVFCLLPSKD
VQSLSLRIMLAEILTTKVLKPVVELLSNPDYINQMLLAQLEYREQVNEHHKRAYTYAPSY
EDFIKLINSNSDVEFLKQLRYQIVVEIIQATTISSFPQLKRHKGKETAAMKADLLRARNM
KRYINQLTVAKKQCEKRIRILGGPAYDQQEDGALEEGEGPQSQKILQFEDILANTFYREH
FGMYMERMDKRALISFWESVEHLKNANKNEIPQLVGEIYQNFFVESKEISVEKSLYKEIQ
QCLVGNKGIEVFYKIQGDVYEILKDRYYPSFIVSDLYEKLLIKEEEKHASQMISNKDETG
PRDEAGEEAADDSTNRINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLR
DEIILIEKERTDLQLHMARTDWWCENLGMWKASITSGEVTEENGEQLPCYFVTVSLQEVG
GVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNK
FLQNLLSDERLCQSEALYAFLSPSPDYLKVIDVQGKKNSFSLSSFLERLPRDFFSHQEEE
TEEDSDLSDYGDDVDGRKDALAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINK
QIRDTVNWIFSEQMLVYYINIFRDAFWPHGKLAPPTTIRSEEQSQETKQRAQQKLLENIP
DTLQSLVGQQNARHGIIKIFNALQEARANKHLLYVLMELLLIELCPELRTHLDQFKAGQV
Download sequence
Identical sequences A0A096NXV4
ENSPANP00000017909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]