SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096PB62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096PB62
Domain Number 1 Region: 557-709
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.36e-30
Family Regulator of G-protein signaling, RGS 0.00076
Further Details:      
 
Domain Number 2 Region: 418-529
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.3e-27
Family DEP domain 0.0058
Further Details:      
 
Domain Number 3 Region: 243-369
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000762
Family PadR-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096PB62
Sequence length 729
Comment (tr|A0A096PB62|A0A096PB62_FUSPS) WGS project CBMC000000000 data, contig CS3220_c000693 {ECO:0000313|EMBL:CEG02310.1} OX=1318456 OS=Fusarium pseudograminearum CS3220. GN=BN846_0086390 OC=Fusarium.
Sequence
MATLSHHQKHTVNQSASPSDTFDQDTTTRSHPPSQATTPRSSPPLEPPPAPPVDATINPS
IVSANTTTGSRSASASGTGSGPAPGTNTPVYVPYNPHQGHHRHTSSVSRLNNRSSTGLFA
LAASAFDRTQNAIAAISEPSVRPRQSSGALSRLSLLTSSSPSSEPSSPDKYHRLRSSSNQ
SLSSGATVDGKIAPQALQANNPPSQPYTTTDPNHPLPYKSSTAAKMHQTSSRLLRMTDDD
RPFTKDFKDLFSTLVVSLLPLSAHRVRLTKVEYTFLSEDAINNLGSLKFSQSNRMPDPKD
PSRIVTTTTTTTFSMAKDMARSICQRFLEARFIESADGKYQQVYTMKGSVWQLTPKGITV
LDRFCSRNGIQQKQVSELANLASTQLVLLERDPQTDKLLHDHGTIEVIFRRFAGSEGRNI
KSTVNAADSDSLHDYRDGLTGVKMAAERKVNGKTYRDTFTGKATTDWLMDCSTIVDKRET
VEVATLFVEFELMEPVAQDRAYMAQNPGCNLFQPTKYAIYQLSQRGKDIVSGAASRGRAS
ESEGGATSQRNGITRDSNTQRLDKILNDPALRLLFREQLRDTHCEENLSFYQDVDEFVRS
CKAATRAAQKAPNTNAMDGIKEIMASAYGIYNAFLAPGSPCELNIDHQLRNNLATRMTKA
VGQDVAMIDTLQEVTSLFEDAQNAVFKLMASDSVPKFLRSPKYEQQLRNYEFDVVGRGPE
RSQSRSNRK
Download sequence
Identical sequences A0A096PB62 A0A096PBV8 A0A096PD33 K3W2X2
XP_009252820.1.42154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]