SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096PCW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096PCW9
Domain Number 1 Region: 253-467
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 1.83e-36
Family Pseudo ankyrin repeat 0.056
Further Details:      
 
Domain Number 2 Region: 137-223,312-362,421-434
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000111
Family Ankyrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096PCW9
Sequence length 599
Comment (tr|A0A096PCW9|A0A096PCW9_FUSPS) WGS project CBMD000000000 data, contig CS3427_c001048 {ECO:0000313|EMBL:CEG02523.1} OX=1318457 OS=Fusarium pseudograminearum CS3427. GN=BN847_0102620 OC=Fusarium.
Sequence
MSSSGSDADPDNERLSSLSHNFGPSASRNNPLFIPELFYLIVEALGEKTDERPEYRNKHS
LANLAATCKYFAATLETVLYTQDIKDGELRGLKCIVFCEEDHVTLGRLNKYPEELLKPYV
DTVFNSIINRDTPNGVVNDSCEYTMLHIAAHKLMYDTMKKLSELGATWTYVRNFQAILSY
NERAKFFFSYPAFQSIFSNVKWAPNLVCLIKKDRHACEILEKFWKESYPFVGQFPFPAGL
LPVGAEDRMTLLHLHLLAVPKHIGADRAEKAIKEYPELINLPTGESQCSIYHIAVMAQSN
FALSNLLIRRLRDRVPYFVDNQGCNPLHTAFKQSLQGKHGRTPQAQTGTTDALSTLLRWD
MNPMMPHTMAPYQHPLLVMGEHAMVDWNGQNRVIKKNIDDIAESEKRWAEAWGFGPVVFT
INRCDSNGNTLLGYITKAIVGYHVETGSKPLEDLFSKIVTEYGADINLDVNSFRTPMPRP
YIHSIRWMANHASGRRRFKKLVNDLGGQLHPAEVAGTEASTLADVDFPPDQPHARCLPVD
HPYALQKPFHLAFIRKSAPQLAEKRAADLQQHAIMVGFLVRNGHTQEEAVAKATQALKL
Download sequence
Identical sequences A0A096PCW9 A0A096PEK4 K3W274
XP_009254193.1.42154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]