SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096XT50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096XT50
Domain Number 1 Region: 2-162
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 5.36e-47
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00000556
Further Details:      
 
Domain Number 2 Region: 163-196
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 0.000000357
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A096XT50
Sequence length 196
Comment (tr|A0A096XT50|A0A096XT50_9CAUD) Ribonucleoside-diphosphate reductase {ECO:0000256|RuleBase:RU003410} KW=Complete proteome OX=1498168 OS=Enterococcus phage ECP3. GN= OC=Viruses; dsDNA viruses, no RNA stage; Caudovirales; Myoviridae.
Sequence
MNTYIELNNQLNIPNNGKIQLDKDKEAVRAFFLEHVNKNTVFFYSLEEKISYLIREGYID
KTVITDKYSMEFIKKLFKFIYSKKFRFDTFMGAYRFYKQYAMKTDDGERYLERYEDRVAF
NALTMGDGDEELAMKIADELINRRYQPATPTFLNAGRLRRGEYVSCFLIQVEDSMSSIGR
TLNSALQLSKLGGGVG
Download sequence
Identical sequences A0A096XT50
YP_009147130.1.64093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]