SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096ZM11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096ZM11
Domain Number 1 Region: 64-172
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 5.49e-45
Family AadK C-terminal domain-like 0.0000111
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000425
Family AadK N-terminal domain-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A096ZM11
Sequence length 173
Comment (tr|A0A096ZM11|A0A096ZM11_ENTFL) AadE {ECO:0000313|EMBL:AIS22014.1} OX=1351 OS=Enterococcus faecalis (Streptococcus faecalis). GN=aadE OC=Enterococcus.
Sequence
KPEDMELFPPEEKGFSYLMLFDDYNKIDLTLLPLEELDNYLKGDKLIKVLIDKDCRIKRD
IVPTDIDYHVRKPSAREYDDCCNEFWNVTPYVIKGLCRKEILFAIDHFNQIVRHELLRMI
SWKVGIETGFKLSVGKNYKFIERYISEDLWEKLLSTYRMDSYENIWEALFLCH
Download sequence
Identical sequences A0A096ZM11

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]