SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A097DBT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A097DBT4
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily BAG domain 0.0000384
Family BAG domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A097DBT4
Sequence length 99
Comment (tr|A0A097DBT4|A0A097DBT4_NPVBM) Uncharacterized protein {ECO:0000313|EMBL:AIS92795.1} OX=271108 OS=Bombyx mori nuclear polyhedrosis virus (BmNPV). GN=Bm(Br)Orf-64 OC=Viruses; dsDNA viruses, no RNA stage; Baculoviridae; Alphabaculovirus. OH=7091
Sequence
MTTSVDAVTKLIRLQNDVLDMMREVDQYLNSNTPDYTIESLNAPGKQFDFLDEMLTKKLI
ESNAIVFDETNKNLKFIHNSINVCLNRCINLITIKHYVQ
Download sequence
Identical sequences A0A097DBT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]