SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A097ESY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A097ESY0
Domain Number 1 Region: 12-70
Classification Level Classification E-value
Superfamily WGR domain-like 0.0000000183
Family WGR domain 0.017
Further Details:      
 
Domain Number 2 Region: 329-546
Classification Level Classification E-value
Superfamily Putative isomerase YbhE 0.0000124
Family Putative isomerase YbhE 0.045
Further Details:      
 
Weak hits

Sequence:  A0A097ESY0
Domain Number - Region: 135-245
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0942
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A097ESY0
Sequence length 630
Comment (tr|A0A097ESY0|A0A097ESY0_9LEPT) Uncharacterized protein {ECO:0000313|EMBL:AIT11042.1} KW=Complete proteome OX=758847 OS=Leptospira santarosai serovar Shermani str. LT 821. GN=LSS_22895 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MKHHLTFKDDKSDKFWNIEVDGTSFTVTYGKTGTAGQTQTKSFDDEKKCLKEAEKLLSEK
LKKGYVEVGIEKNDSVNKKEEIVESKNGYLEEWETIVKSKDLPKALVRHFAYLADTPGYG
RVLESVMKVAISAQINEDCLFIEFPSDTLIATPPANLQHHHEWPESFRKLAAVHGSLELE
EARLYLGDHGLVENYYLEKIEWGKTLDDPSKVYSPLVDYSDWWFYHPYTKNPTNEPALCF
ISHEDLSVADPVEQNAGALFLSRMSEILELYITPSTNENSTETKTSISLKPFLKLSRCVR
QGLIHRNDLITLEPKLAETSWEHYPESINRIAIYDISKPSQPVLKTFLPLELTPYEMCIH
RDRLFVFSAGSIEMGTKFNLTVYDITSHDEIILLKELDSELIPSNEKYKLDVVSIASHSS
LLITGDYLLFSFESLGYRDLRDFEFKVYNIQTLEYIFTQSIEEGWPNAAQLCGNEVFQYI
DYEIRKISITNDTLNAELVLKWPQDTIRGVYAKRGNFFYLGNMRNDLLYTHNEKGQQIGK
VKVPGKALVTVGKMWLHENILIIKTGFFLYINSDGSLVHLQSDWEPKDSSFINDRNKLTF
HENKMLVPRITGDKTPGKEFEFQIFEMILK
Download sequence
Identical sequences A0A097ESY0 A0A0E2DU96
WP_004490293.1.18456 WP_004490293.1.79523 WP_004490293.1.83002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]