SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A097I5D8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A097I5D8
Domain Number - Region: 39-66
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00942
Family SMI1/KNR4-like 0.019
Further Details:      
 
Domain Number - Region: 95-256
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0186
Family Galactosyltransferase LgtC 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A097I5D8
Sequence length 271
Comment (tr|A0A097I5D8|A0A097I5D8_ACIBA) LPS glycosyltransferase subfamily {ECO:0000313|EMBL:AKA30364.1} KW=Complete proteome OX=470 OS=Acinetobacter baumannii. GN=ABUW_0594 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MKKILILCVSLKGSNERQEKIKQQHQSLQSVIHDIQIDFEFFEAIYGKKLPNEYLTFLNL
SRQFAGLCDHELGPSELGCWLSHMIIWQRLAQGDYAAYDRIIIIEDDVIFQTEHIQQKLH
SLLETNPAFAFLGGHSEPSRRRIRGYVSKDELYFNMTGPKDLYTATYAYSLTRETAQDFV
NKQIKKLTYIDDWKYLLEGDISTPFYYCFEHDDEMQSHIASDRKTYMKKPNRFKKNFNKM
KNDLISRVISLFIFKKIIRLAYFLQSAQTQK
Download sequence
Identical sequences A0A097I5D8 A0A0J0ZSB3
WP_000721907.1.100152 WP_000721907.1.11500 WP_000721907.1.11977 WP_000721907.1.12703 WP_000721907.1.13263 WP_000721907.1.13480 WP_000721907.1.15159 WP_000721907.1.16082 WP_000721907.1.16288 WP_000721907.1.16787 WP_000721907.1.1753 WP_000721907.1.17616 WP_000721907.1.20127 WP_000721907.1.20532 WP_000721907.1.21462 WP_000721907.1.21644 WP_000721907.1.21810 WP_000721907.1.22793 WP_000721907.1.24846 WP_000721907.1.26831 WP_000721907.1.31121 WP_000721907.1.34657 WP_000721907.1.35291 WP_000721907.1.35337 WP_000721907.1.36289 WP_000721907.1.3720 WP_000721907.1.39517 WP_000721907.1.40552 WP_000721907.1.43766 WP_000721907.1.46080 WP_000721907.1.50111 WP_000721907.1.50164 WP_000721907.1.50216 WP_000721907.1.51536 WP_000721907.1.52426 WP_000721907.1.55447 WP_000721907.1.55484 WP_000721907.1.56353 WP_000721907.1.60408 WP_000721907.1.60678 WP_000721907.1.62023 WP_000721907.1.62683 WP_000721907.1.6289 WP_000721907.1.64646 WP_000721907.1.66752 WP_000721907.1.67578 WP_000721907.1.67823 WP_000721907.1.68015 WP_000721907.1.68603 WP_000721907.1.70461 WP_000721907.1.749 WP_000721907.1.74989 WP_000721907.1.75620 WP_000721907.1.75628 WP_000721907.1.75896 WP_000721907.1.76329 WP_000721907.1.76571 WP_000721907.1.7865 WP_000721907.1.79789 WP_000721907.1.80270 WP_000721907.1.82542 WP_000721907.1.85306 WP_000721907.1.85683 WP_000721907.1.86102 WP_000721907.1.87216 WP_000721907.1.88040 WP_000721907.1.91832 WP_000721907.1.93437 WP_000721907.1.94012 WP_000721907.1.94224 WP_000721907.1.9439 WP_000721907.1.96220 WP_000721907.1.96760 WP_000721907.1.97038 WP_000721907.1.97300 WP_000721907.1.97647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]