SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A097KR48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A097KR48
Domain Number 1 Region: 13-157
Classification Level Classification E-value
Superfamily Homing endonucleases 4.86e-27
Family Group I mobile intron endonuclease 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A097KR48
Sequence length 171
Comment (tr|A0A097KR48|A0A097KR48_9CHLO) Putative LAGLIDADG homing endonuclease {ECO:0000313|EMBL:AIT95634.1} OX=381761 OS=Elliptochloris bilobata. GN=orf171 OC=Microthamniales; Elliptochloris.
Sequence
MKNKATHISEVPPDKGHYVAGFVDGEGSFYISARVRQDYPTRWKFGLHFNISNRDKVVLE
ICKKYVGCGTIRETDRGNGFYVLEVQDRKKLREFVIPFFSRFGFLSNKKRSEFRIFQEAL
VLLDNGIRTDAELKAFLRLREKLNQLRKTNISNTDAVILESFVFMRESSET
Download sequence
Identical sequences A0A097KR48

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]