SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098AYY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098AYY4
Domain Number 1 Region: 140-284
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 3.61e-52
Family AadK C-terminal domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 1-137
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.14e-41
Family AadK N-terminal domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A098AYY4
Sequence length 289
Comment (tr|A0A098AYY4|A0A098AYY4_DESHA) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:KTE92361.1} KW=Complete proteome OX=49338 OS=Desulfitobacterium hafniense (Desulfitobacterium frappieri). GN=AT727_19425 OC=Desulfitobacterium.
Sequence
MRSEKEMMEIILSTAKKDERIRAVYMNGSRTNPNVPKDIYQDYDIVFVVTETDSFLADKD
WIGGFGKPLIVQEPDLNDNAWGEQHDFSRRYAWLILLEDGNRLDLVIEIKEEAQKNFIGD
KLTILLLDKDGFLPEIPRPTDEDYHLKKPNEAQYRACCNNFLWCLNNVAKGIARDELPYA
MEMYNCVVRNDLKDMISWYIGINTGFSVSVGKMGKHFKKFLTQELYTMYAQTYSDSSYEN
FWAAIFIACELFRSIAPEVADYFGYTYNWQDDKNMATYLNRVKNNDFMQ
Download sequence
Identical sequences A0A098AYY4 B8FU63 G9XVL2 Q24XY2
138119.DSY1321 272564.Dhaf_2449 gi|89894067|ref|YP_517554.1| gi|219668478|ref|YP_002458913.1| WP_005816862.1.13927 WP_005816862.1.73069 WP_005816862.1.80252 WP_005816862.1.88067 WP_005816862.1.94859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]