SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098B529 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098B529
Domain Number 1 Region: 9-141
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 1.14e-20
Family HEPN domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A098B529
Sequence length 146
Comment (tr|A0A098B529|A0A098B529_DESHA) HEPN {ECO:0000313|EMBL:CDX03485.1} OX=49338 OS=Desulfitobacterium hafniense (Desulfitobacterium frappieri). GN=DPCES_3599 OC=Desulfitobacterium.
Sequence
MDSWEKYEYWLDISEYDLETAEANYKSGRYLYVVFMCQQAIEKIVKGLHILYLNKEADRT
HNIVRIFNTIFDEPTNRELIQDAEFDKIKEANTEFFAELIYFYISERYPTYKQKLSSFVD
QEKAKEILDKSKGVFEWLKSLSQYKI
Download sequence
Identical sequences A0A098B529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]