SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098DXU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098DXU9
Domain Number 1 Region: 298-390
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.29e-18
Family Flavin-binding PAS domain 0.00028
Further Details:      
 
Domain Number 2 Region: 146-259
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000471
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A098DXU9
Sequence length 656
Comment (tr|A0A098DXU9|A0A098DXU9_GIBZE) Uncharacterized protein {ECO:0000313|EMBL:CEF86157.1, ECO:0000313|EnsemblFungi:CEF86157} KW=Complete proteome; Reference proteome OX=229533 OS=(Wheat head blight fungus) (Fusarium graminearum). GN=FGRAMPH1_01T16823 OC=Fusarium.
Sequence
MPTINAHRTFEPPSMPSPPDFERRRSTASSLSHNTDSLGGLQSPPLRSRSSRPKSAKFSS
YRLRSNSGLSLHTNEDILRQYTDYHPDGTPRAGLYSNGGGQWSAERLRSIDSVASSARSQ
RSSIAYTESDSSGELPIPDLVGREMFDMVMADHAASGQLWKFAADRGVGQNVDYLMKIRD
YIQSLEQVVIQLSTISTSYTSITATSPLGLPPPMSKALNTNIKHLTTSLIPSLENMFLES
KAFIEQRIVREIFPDFVKQQLSQCTSLALSLDAEGDSPLNPYPGLKGSFCLSDPSRSGNP
IMLASDEFEELTGYSRTEVLAHNCRFLQGPQTDRDRIANMRSAIWRNDECTELLLNFRKD
GTPFWNLLFLCPLLDKTGKTKFFMGAQIDVSSSIHDTDDVLKVLSYGAMEEERATERCSS
RWASEASHDEPEHDEAFGIKNNTLKSKKATSFFKSFKKANPPPPSPPLSPRRSSDRPRSS
GPTMDKTYSTRSVIRRFSSQPEMLMSTYARYMILEHVPSYPKSLGAMPLDQEGKYPPKLC
VSFYSKEMSEALDLGPATEAVIGKDIFDIMTEQATLPSVTKAFKLTVRDLVVRDGKSVSL
DLALANHIPRRANTSRSPTSDSDGPHKKPAKLMSHWTPLKDSEGHVKYVVMIVSPI
Download sequence
Identical sequences A0A098DXU9
5518.FG04991.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]