SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098ESD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098ESD9
Domain Number 1 Region: 1-154
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.14e-38
Family SMI1/KNR4-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A098ESD9
Sequence length 156
Comment (tr|A0A098ESD9|A0A098ESD9_9BACI) Cell wall assembly/cell proliferation coordinating protein, KNR4-like protein {ECO:0000313|EMBL:CEG25314.1} KW=Complete proteome; Reference proteome OX=1476857 OS=Bacillus sp. B-jedd. GN=BN1002_00107 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MSVETYQKAKQIIQTNEDLADFIGGRTNELIKLAEEKLGIKFTGLYLDYLQTFGAGNFGA
QEVYGIINNNFENSSVPDAIWYTLTERKEINLPNNLFVIYDTGSDELFCLDFNQLDEKGE
PKVVSFVPGIDLESQSYEIIANDFGDFLLDLVKQEV
Download sequence
Identical sequences A0A098ESD9
WP_048823074.1.70412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]