SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098FCH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098FCH6
Domain Number 1 Region: 8-145
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.49e-21
Family SMI1/KNR4-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A098FCH6
Sequence length 151
Comment (tr|A0A098FCH6|A0A098FCH6_9BACI) SMI1 / KNR4 family protein {ECO:0000313|EMBL:CEG31935.1} KW=Complete proteome OX=1478 OS=Bacillus simplex. GN=BN1180_02092 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MVSITGYGKAREEAVNNFQEFVGFEIPEDYKQFLLKHNGGTTTVQNCKFYVDGLDTLVCL
QALYGLELIDKELDLQKWHEENREDLHKNCIIIGNDTCAGKILLINNEEEKGVYFWDQGW
YSDPSSQDENIYKVASSFKSFIEGLKVPEEI
Download sequence
Identical sequences A0A098FCH6
WP_081088561.1.80012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]