SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098FEH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098FEH6
Domain Number 1 Region: 9-126
Classification Level Classification E-value
Superfamily YdhG-like 9.94e-22
Family YdhG-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A098FEH6
Sequence length 197
Comment (tr|A0A098FEH6|A0A098FEH6_9BACI) YdeI {ECO:0000313|EMBL:CEG32650.1} KW=Complete proteome OX=1478 OS=Bacillus simplex. GN=BN1180_02814 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MTKSRTNPKVDEFLGKAKKWKEEFETLRNIVLDCELTEEFKWMHPCYTFENKNIVLIHGF
KEYCAILFHKGALLQDAHGLLIQQTENVQGARQIRFTNVQEIVATESILKAYIHEAIEVE
KAGLEVEFKKNEEFIIPEELHNKFDDNPALKTAFEALTPGRQRAYILYFSQAKQSKTRES
RIEKCMQKILDGKGLKD
Download sequence
Identical sequences A0A098FEH6
WP_048686370.1.29656 WP_048686370.1.49991 WP_048686370.1.80012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]