SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098GCU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098GCU8
Domain Number 1 Region: 377-439,623-652,714-736,841-897
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000103
Family Pseudo ankyrin repeat 0.023
Further Details:      
 
Domain Number 2 Region: 786-971
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000148
Family Ankyrin repeat 0.0094
Further Details:      
 
Domain Number 3 Region: 652-745
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000718
Family Ankyrin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A098GCU8
Sequence length 1078
Comment (tr|A0A098GCU8|A0A098GCU8_TATMI) Uncharacterized protein {ECO:0000313|EMBL:CEG59825.1} KW=Complete proteome; Reference proteome OX=451 OS=Tatlockia micdadei (Legionella micdadei). GN=LMI_0478 OC=Legionellaceae; Tatlockia.
Sequence
MQFQIILQWINSDKIVHFWNKKITYRDLEQEYSAIHELNRRLIAEARIARFSSSFLAPQK
LNELEKNNNLLTLIDLCRPALKETGEATSFLMALHYLLALPKDARPANHNEKTVFLFNNL
LKENPVDTLKFYHQNKELFAEYYEINSIAEKTIRKEQALPSVRAYLETLTDALKDQKDPL
GLIALFKEKIADTEKYAALILWLIQRKVPSNQIIETHLLHDFMRYNLYDLSSPDSAVSHL
YSLLEEFPEAQNLVQQAKKTSCGERGFCNYALDGSLVFEEEELEYVEAKPALCKFSPTAF
NFGSLCQLFDQSFLIAAISWVARTENTDWFILLKGHLNQPGVITEQLPILINLISKAQDP
KLTKTLATLIEDSTAEQLVSLHQGAILHLLSYKPSLVTKISGMNIENYVEQIISTNSSDF
DTTMQLLQLLKLLIINKHDAANSVFERLIDFLLSQQSNLIEDDEIIRQLKRHPEYIPRLS
YRCKVLHSQLQDCIEANTQSQLDTTCYNSIEDVWFDVNRKLNLLHILDPQSDSEVIDKYS
LYALIAKAAYKSLGRHFDLDTFIEALSLPEPERGETSIQERVLIEILAAIEDEDIKDKII
TKLQGEPINCMDWMTKAYGGTSLFVKAAEHGNNMLLNLLVDNREPDKDSYNDAVHLSAAN
GHWLTVSHLCRHFPEKVRNSTIANTLILAARHGKVDIVEQLCDTEMYPPLSGKAHAQLLE
TAVENNQLAVVECLCTLTSPVPNKNLIEKLFNLALKHKHLTILIYFSELPQNAPHQLQID
KAFSQAVLNNDEDSLKCLGNLNTVKPGHLVVERNFKKAAMMGLLNMIVCLGNLPGYTLNK
PEIINGAIQEAATYGHLPVVKHLLSSIKDTRTRQDALVSALSAATKSGKLEIIGYLCNLS
SSQPVQNAIFPLLLWAIKSKNSPIVELFCNLKTNKPHPRVLTRLLQEAIKSGELDIVKSI
CQAFSPIPQRNLDLAIPMAVQWRQPIILSYLYELSENKPKPKMIRFALNKAISTNQENAA
IYLRNKLLELRYHTETEQSDLTHNTSRQLESLGLFGKEKSGKADPLSEKRLTSTAVFA
Download sequence
Identical sequences A0A098GCU8
WP_045098349.1.35660 WP_045098349.1.44742 WP_045098349.1.46019 WP_045098349.1.8371 WP_045098349.1.9032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]