SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098LWE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098LWE0
Domain Number 1 Region: 25-80
Classification Level Classification E-value
Superfamily BPTI-like 3.12e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0016
Further Details:      
 
Domain Number 2 Region: 85-139
Classification Level Classification E-value
Superfamily BPTI-like 5.11e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A098LWE0
Sequence length 140
Comment (tr|A0A098LWE0|A0A098LWE0_TURCE) Ccr_19 putative toxin {ECO:0000313|EMBL:JAC94797.1} OX=1077925 OS=Turridrupa cerithina (Sea snail) (Crassispira cerithina). GN= OC=Turridrupa.
Sequence
METLRFAAVLLLVVQLATIRADEATSDVCQQPVKQGMCMAYFLRYYFSPQSGQCRQFIYG
GCGGNGNNFQTKEVCEATCLKDRATRDVCQQPKVVGPCKAAIRRFFFNSARGVCEEFIYG
GCRGNGNNFDTKKQCEAACA
Download sequence
Identical sequences A0A098LWE0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]