SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098LXY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098LXY0
Domain Number 1 Region: 182-263
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.96e-26
Family Thyroglobulin type-1 domain 0.00019
Further Details:      
 
Domain Number 2 Region: 22-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.25e-24
Family Growth factor receptor domain 0.0000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A098LXY0
Sequence length 270
Comment (tr|A0A098LXY0|A0A098LXY0_9SAUR) Insulin-like growth factor-binding protein 5 {ECO:0000313|EMBL:JAC95327.1} OX=1550645 OS=Hypsiglena sp. JMG-2014. GN= OC=Toxicofera; Serpentes; Colubroidea; Dipsadidae; Hypsiglena.
Sequence
MFLMQVLLVSLCLGLSQGLGSFVHCEPCDEKALSMCPPSPVGCELVKEPGCGCCMTCALA
EGQSCGVYTERCAQGLRCLPRQGEEKPLHALLHGRGVCLNEKSYREQAKNERESREHEEP
TTSEMAEETYSSKMYRNKGLERYSGLKAEAVKKDRKKKLTLSKIVGGAENTAHPRVAAPE
LRPEFELGPCRRQMEASLQELKSSQRMIPRAVHLPNCDRKGFYKRKQCKPSRGRKRGLCW
CVDKYGLKLPGTDYVAGDLQCHNFDSGNTE
Download sequence
Identical sequences A0A098LXY0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]