SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098M9R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098M9R7
Domain Number 1 Region: 10-91
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 8.37e-34
Family Ribosomal L27 protein 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A098M9R7
Sequence length 103
Comment (tr|A0A098M9R7|A0A098M9R7_9BACL) 50S ribosomal protein L27 {ECO:0000256|HAMAP-Rule:MF_00539} KW=Complete proteome; Reference proteome OX=268407 OS=Paenibacillus wynnii. GN=PWYN_27610 OC=Paenibacillus.
Sequence
MLKLNLQLFASKKGVGSTRNGRDSQSKRLGVKRADGQTVTGGSILVRQRGTKIHPGTNVG
IGKDDTLFAKVEGVVKFERWGRDRKKVSVYPVDVAPVAATLEA
Download sequence
Identical sequences A0A098M9R7
WP_036658281.1.86096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]