SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098MDI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098MDI2
Domain Number 1 Region: 145-294
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.66e-24
Family SMI1/KNR4-like 0.011
Further Details:      
 
Domain Number 2 Region: 24-115
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000142
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A098MDI2
Sequence length 300
Comment (tr|A0A098MDI2|A0A098MDI2_9BACL) Cell wall assembly protein {ECO:0000313|EMBL:KGE20113.1} KW=Complete proteome; Reference proteome OX=268407 OS=Paenibacillus wynnii. GN=PWYN_12795 OC=Paenibacillus.
Sequence
MRDDLLDQLGSWHEEDEYQEIIDAIMEIPPGDRDYVLTSHLGRALNNLGRYEDGLEQFLT
IAEEGKEDPLWHYRIGVSYYYLEQYDQALKEFKMADKLEPDDEDTLEFIDWCRREKAKKP
AKVVKAAIAAFDSSNFWNDSEDALEQYVSEPPTPELIASVEEELVFKLPAFYIDMMKLHN
GGIPNNTHYPIEGDASGAKSHISVSGILGIGREKSLSLCGDLGSRYRIENGGYPEFGVVI
CDCSSEHEVVMLDYRSCGNDGEPEVVHVDRENNYKITYLAKNFETFIRGLVNEETYVTKQ
Download sequence
Identical sequences A0A098MDI2
WP_036653760.1.86096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]