SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098MTQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098MTQ2
Domain Number 1 Region: 304-446
Classification Level Classification E-value
Superfamily L domain-like 0.000000000221
Family Internalin LRR domain 0.0042
Further Details:      
 
Domain Number 2 Region: 12-68
Classification Level Classification E-value
Superfamily WGR domain-like 0.0000000615
Family WGR domain 0.013
Further Details:      
 
Weak hits

Sequence:  A0A098MTQ2
Domain Number - Region: 161-268
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0569
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A098MTQ2
Sequence length 657
Comment (tr|A0A098MTQ2|A0A098MTQ2_LEPIR) Uncharacterized protein {ECO:0000313|EMBL:KGE24932.1} KW=Complete proteome OX=57678 OS=Leptospira interrogans serovar Lai. GN=IQ65_15785 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MNHQLTFKDDKSDKFWNIEVSGNSFTVTYGKTGTSGTSQTKTFETEETCIKEAQKLLSEK
LKKGYIEGNIQTSSPKEKTSVQTPNDFHKEWEKIVNSKDLQNDLTKHFSYLADSSGFEPV
IRKIFEHTNVVKINGNTLIVEFKNGNTLTAESPGNPSSYKKFPKSFLKLIEKHNTLKTNR
LELGKCYFDFDIFDEGDRVYEIFDGKESNVLCPLKFMDNSDWIYHPTEKNKEGEPAIFPI
IHELEDEINPVYYNIGSLFLKQLCDEFEIKIEIPVDERPVDPSADLKTNWWSNLSDAWKQ
AFRNQFENKDKEPTFETILTLERLNLNDSTISDLKPLEALLAEKKFKLEIIRLANTSVSD
IAVLAMAKKKLFSVDISGTPVKDVSALKEINFLIANRCTELDFSTVAKLKKLRQLSLQDT
KLNDLEFLHDFTELEQLNINGTPLTDEQILKFQIRFQKDRLEKNKTVSYGRDPLKLDIHP
EIKDPLLRALADNRDYKPELALETGEKLLAQRAERKDIKQILKDLISICDQQWRKYLYIK
TPEGEKKYEFFNQKEKRFQYILDTDDFSIPVSITSLSDPISEIITLIPLIYENKKKYKAF
STIENNSFYHVNAILNIISKTKYYDVTLAQIEEAVKKSDYVEYKIKENGDMYIKVKQ
Download sequence
Identical sequences A0A098MTQ2
WP_020784491.1.15012 WP_020784491.1.27867 WP_020784491.1.3175 WP_020784491.1.36581 WP_020784491.1.382 WP_020784491.1.56629 WP_020784491.1.71080 WP_020784491.1.77874 WP_020784491.1.97385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]