SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098RNR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098RNR8
Domain Number 1 Region: 1-171
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.03e-22
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 175-291
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.000000129
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A098RNR8
Sequence length 314
Comment (tr|A0A098RNR8|A0A098RNR8_9RHIZ) Nucleotidyltransferase {ECO:0000313|EMBL:KGE80312.1} KW=Complete proteome OX=1510041 OS=Rhizobium sp. H41. GN=LW14_23820 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MALSNTEIRYYDSNVLRLPADKRKEYHAQVDRLIEELRKSVRDKTEIKITKVVKAGSFAK
FTILRKTTYDPVDVDVVFYISGKDVTKETLDSLSQTIYDLLIKIYPTKSVEDFEIQRKAA
TVTFVGTGLSVDIVPVIEDETRPGYGWQFDIHDGSRMQTCAPCQIQFVRDRKNQDSDFRT
LVRLAKKWRNYAEIKPLKSFAIELIMAHVLQTQGSQGSIEQRFRNFLLYVAQSGLKEKIS
FLENTQPHGSFSDPVVILDPVYSFNNVASRISEQERKDIVAAAQEAWETANFASVEDDNA
VWKEIFGPGFKVED
Download sequence
Identical sequences A0A098RNR8
WP_037093524.1.31706 WP_037093524.1.51174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]