SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098SA52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098SA52
Domain Number 1 Region: 24-173
Classification Level Classification E-value
Superfamily OmpH-like 3.4e-28
Family OmpH-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A098SA52
Sequence length 173
Comment (tr|A0A098SA52|A0A098SA52_9BACT) Membrane protein {ECO:0000313|EMBL:KGE89005.1} KW=Complete proteome; Reference proteome OX=1524460 OS=Phaeodactylibacter xiamenensis. GN=IX84_04255 OC=Haliscomenobacteraceae; Phaeodactylibacter.
Sequence
MNQLSLKKALLTLTIVAAGTFTTFAQRIAYVNVNTILESIDEYQAAQRDLDKTAQVWRQE
IAQEYDKIKGMYNRYQAEQVLLSEDERQRREEEIMGKEQEVRDLQKSRFGPEGDLFKLRQ
DLVRPIQERVYAAIEEYAQERGYDFIFDKSSGAGMIFSNPSYDKTEDVMKKLK
Download sequence
Identical sequences A0A098SA52
WP_044216776.1.38272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]