SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A098TII9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A098TII9
Domain Number 1 Region: 10-109
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000628
Family Serralysin-like metalloprotease, C-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A098TII9
Sequence length 121
Comment (tr|A0A098TII9|A0A098TII9_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:KGF71924.1} KW=Complete proteome; Reference proteome OX=1497020 OS=Neosynechococcus sphagnicola sy1. GN=DO97_14290 OC=Neosynechococcus.
Sequence
MGAATIPSRGGSGNDRFIFDTGVPFDSSTIGIDTITDFASGQDYLVLDRTTFTQLGTTVS
FAAVGTEADAATSAALITYITATGSLYYNQNGSNTGFGLGGQFADLSDGLGLTTTDFSIN
P
Download sequence
Identical sequences A0A098TII9
WP_036535381.1.87483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]