SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099BDE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099BDE8
Domain Number 1 Region: 33-225
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 2.62e-27
Family Chemotaxis phosphatase CheZ 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099BDE8
Sequence length 227
Comment (tr|A0A099BDE8|A0A099BDE8_9HELI) Chemotaxis protein {ECO:0000313|EMBL:KGI53573.1} KW=Complete proteome OX=425400 OS=Helicobacter japonicus. GN=LS65_05895 OC=Helicobacteraceae; Helicobacter.
Sequence
MTQEELDSLMNGEPDVGEIDNTLDASEEDEEFQKITVDPNDFRAEADKKWPPPPPTEDHK
IVHQLDEVTKDTEVKGTQIFDQLEVMSNGADQISKLAKSIELYLNEQEELFGKLCATFPH
IQTFQSALESTKNTKEHNKNIINATNDISDAAMQAMDLMQYQDIHRQKIERVINVMRALA
QYMNSLFEGKIDDSKRVSSAVFIAGDDKEDVVNEDDIEAMIASFGAK
Download sequence
Identical sequences A0A099BDE8
WP_034362332.1.65404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]