SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099E6U4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099E6U4
Domain Number 1 Region: 4-161
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 9.42e-67
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099E6U4
Sequence length 163
Comment (tr|A0A099E6U4|A0A099E6U4_9PSED) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome OX=658612 OS=Pseudomonas sp. H2. GN=MD26_08880 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSALVGVIMGSKSDWSTLSHTADMLEKLGIPYEVKVVSAHRTPDLLFQYAEEAEGRGIEV
IIAGAGGAAHLPGMCAAKTHLPVLGVPVQSSMLSGVDSLLSIVQMPAGVPVATLAIGRAG
AINAALLSASILGAKYPQYHAALKQFRTEQTDTVLDNPDPRQA
Download sequence
Identical sequences A0A084C947 A0A099E6U4 A0A0C5SER4 A0A132G315 A0A166LT74 A0A1X7C587 A0A285YTK9 R9V891
gi|512580128|ref|YP_008098096.1| gi|512688454|ref|YP_008116434.1| WP_016489856.1.1467 WP_016489856.1.17209 WP_016489856.1.18387 WP_016489856.1.25194 WP_016489856.1.25404 WP_016489856.1.29846 WP_016489856.1.57327 WP_016489856.1.62999 WP_016489856.1.66754 WP_016489856.1.68951 WP_016489856.1.75217 WP_016489856.1.75421 WP_016489856.1.76632 WP_016489856.1.7826 WP_016489856.1.79655 WP_016489856.1.87386 WP_016489856.1.96571 WP_016489856.1.99808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]