SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099HYF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A099HYF1
Domain Number - Region: 3-26
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00259
Family Rubredoxin 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A099HYF1
Sequence length 82
Comment (tr|A0A099HYF1|A0A099HYF1_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:KGJ50809.1} KW=Complete proteome OX=1538552 OS=Clostridium sp. NCR. GN=KD33_02155 OC=Clostridium.
Sequence
MIKCPRCGKEVSNRPGTVCPRCGLDVGKVTEKVRCPEASCRALVSKKLEYCPKCGCKLKG
YNLNEILKIAKMRFSNNFPDEE
Download sequence
Identical sequences A0A099HYF1 A0A0M3DJM3 A0A1X2JHM6 T4VDZ3 T4VX34
WP_021429910.1.14186 WP_021429910.1.16410 WP_021429910.1.41918 WP_021429910.1.53783 WP_021429910.1.58152 WP_021429910.1.64467 WP_021429910.1.73967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]