SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099I3T4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099I3T4
Domain Number 1 Region: 6-143
Classification Level Classification E-value
Superfamily Ribosomal protein L13 3.14e-54
Family Ribosomal protein L13 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A099I3T4
Sequence length 145
Comment (tr|A0A099I3T4|A0A099I3T4_CLOIN) 50S ribosomal protein L13 {ECO:0000256|HAMAP-Rule:MF_01366, ECO:0000256|SAAS:SAAS00766472} KW=Complete proteome OX=1522 OS=Clostridium innocuum. GN=ADH65_19305 OC=Erysipelotrichaceae; Erysipelatoclostridium.
Sequence
MRQTTFAKPAEVERTWYVVDGTGKTLGRLATEVASVLRGKHKPTYTPNVDCGDFVIVTNA
DKIELTGNKLDTKKYYNHSGYAGGLRTRTARVMKDNYTVEWVERAIYGMLPHTKLGDKMR
RHLFVYEGSEHPHTAQKPVELKIKG
Download sequence
Identical sequences A0A099I3T4 A0A1C7HUM2 G1VSL3 H1B6Z7 N9VB63 R6UIA4 T4NAQ3
WP_002605778.1.20735 WP_002605778.1.20955 WP_002605778.1.25948 WP_002605778.1.34721 WP_002605778.1.34798 WP_002605778.1.49693 WP_002605778.1.52811 WP_002605778.1.66570 WP_002605778.1.75964 WP_002605778.1.80220 WP_002605778.1.89667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]