SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099L2B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099L2B0
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.57e-26
Family SMI1/KNR4-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A099L2B0
Sequence length 152
Comment (tr|A0A099L2B0|A0A099L2B0_COLPS) Cell wall assembly/cell proliferation coordinating protein, KNR4-like protein {ECO:0000313|EMBL:KGJ96008.1} KW=Complete proteome OX=28229 OS=Colwellia psychrerythraea (Vibrio psychroerythus). GN=GAB14E_1759 OC=Colwelliaceae; Colwellia.
Sequence
MKTIDLFVEHWASKHVMTPIDSQDIIELETKLNASLPESYKYLISTYGLVHTPNVLTRIC
DLGVDISEVQDFLSLEDIYSLSKLYEMSGMPKGHILFASDCKGNMFCFKFEDCVNETKDV
PVWFYNHGLCTVNKASNSFSDWLEQFNALENS
Download sequence
Identical sequences A0A099L2B0
WP_033081463.1.59318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]