SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099LRR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099LRR2
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 2.63e-16
Family Family 1 bi-partite nucleotidyltransferase subunit 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099LRR2
Sequence length 140
Comment (tr|A0A099LRR2|A0A099LRR2_9VIBR) Uncharacterized protein {ECO:0000313|EMBL:KGK10186.1} KW=Complete proteome OX=29495 OS=Vibrio navarrensis. GN=EA26_02200 OC=Vibrionaceae; Vibrio.
Sequence
MIQFDKFERSLHLLQEQNDRLNKLQIEATELWIIEAVKESIIQRFETCWDSLWKITKRYL
SENIGLPEVPNGPNPVLRLTHENMLLPSSIERWMHYAKARVATSHDYSGEKADEALALMN
DFVTDAILLYQTLSGQAWKK
Download sequence
Identical sequences A0A099LRR2
WP_039422912.1.33170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]