SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099P1Q5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099P1Q5
Domain Number 1 Region: 10-208
Classification Level Classification E-value
Superfamily eIF4e-like 7.98e-65
Family Translation initiation factor eIF4e 0.000000897
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A099P1Q5
Sequence length 213
Comment (tr|A0A099P1Q5|A0A099P1Q5_PICKU) Eukaryotic translation initiation factor 4E {ECO:0000313|EMBL:ONH77316.1} KW=Complete proteome; Reference proteome OX=4909 OS=Pichia kudriavzevii (Yeast) (Issatchenkia orientalis). GN=BOH78_0495 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
Sequence
MSTEELNNATKDLSLDEKKDVTALENPAEFNVKHPLNSTWTLWYTKPAVDNTESWADLLK
PVVTFNTVEEFWGIFHAIPKVNELPLKSDYHLFRGDIKPEWEDSQNSDGGKWFCQFKGKR
EDMNELWTRTLLSVIGETIEKAETETNEVNGVVFNVRRGTCKIGLWTKSCDEERLRAIGE
VFKKVLKLGDEDKIEFIRHKDSDNRNAKPMIIM
Download sequence
Identical sequences A0A099P1Q5
XP_020546413.1.21716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]