SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099P2M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099P2M1
Domain Number 1 Region: 115-202,232-299
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.76e-17
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A099P2M1
Sequence length 648
Comment (tr|A0A099P2M1|A0A099P2M1_PICKU) Uncharacterized protein {ECO:0000313|EMBL:KGK38514.1} KW=Complete proteome; Reference proteome OX=4909 OS=Pichia kudriavzevii (Yeast) (Issatchenkia orientalis). GN=JL09_g2336 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
Sequence
MSIFRNIKEFFHNITTNDHYAQYGSNDKKGKKKSSNRSTPTGSKNGSSVSLINKNNKVNS
TSVSDSKNSTSSNADNSNSKIPYRPGMRSQLHNDSQIELRNYENGQPQKDIVDIWEAIDD
WLDREFPELADDIQGGATANDLNAFEDDLDINLPAAFRDSYQIHDGQVSMGKTRGLVFSY
PLMDLESIAAETNIWRKVYEKFEKKDASVISSAFGPQSSCPPKYINEIYYDPLWIPFVKD
NVGNNIAIDLNPNAAGKWGQVILFGRDYNTKFVVAESFGEFLNDICEELSAGHFEIDDDE
DLNYVRNGKNYNYFDVLRSKSISRAKKLDPSFTVNEEKNVNDAELLVQKSKSLNIKSEDT
PVNTSNITKSSHIAETLISPANEDKKAFLPSKENVATNDSFVIDDDVPSIEENAEEPAVE
AIAETVEEPAVESAPEHVTETVEENAEEPAVEAIAETVEEPAVESAPEHVTETVEENAEE
PAVEAIAETVEEPAVESAPEHVTETAEEPTAEKPTAEEPTAEEHVAETVDEPAVEEPVTE
TADEPVVESAPEHVAETAEEPTAEEPTAEEPVAETVDEPAVEATPEPVDEPATESTEAAE
GSEDSSTAENGNNEESVAQETTASSETPVNATKSSNKKKKNKKKKGKK
Download sequence
Identical sequences A0A099P2M1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]