SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099P5H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099P5H3
Domain Number 1 Region: 44-112
Classification Level Classification E-value
Superfamily Fumarate reductase respiratory complex transmembrane subunits 0.000000000015
Family Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) 0.0074
Further Details:      
 
Domain Number 2 Region: 242-317,413-466
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000285
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099P5H3
Sequence length 516
Comment (tr|A0A099P5H3|A0A099P5H3_PICKU) Uncharacterized protein {ECO:0000313|EMBL:KGK40293.1} KW=Complete proteome; Reference proteome OX=4909 OS=Pichia kudriavzevii (Yeast) (Issatchenkia orientalis). GN=JL09_g641 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Pichia.
Sequence
MLRITNSSWAAFARSGVIRPTLHARSIVTVKTTDAEEQSILIAQRKNRPVSPHLEIYQKQ
LTAVLSALHRITGVGLAAGFYAVTVSYAAGVVDSASLVELYQSIPSVGQWAFKRSCNSSM
GFLGKKWKELVYTLTSNDRYAGYHTSKAVNSLTEYDSEGEEANDAKEIQDNIPVTADEKQ
QAQLVLDAWHIIEDVINLDMNNPDPNNNHFTLNSKNSQNYDYNYDMDFNLDLEEIPDAED
FMNSLSSPCTFKDLQVAQKHLGVKFPYPVIKYFQTHDGQEVAPSSTKKLGLMYGLQLLSL
AEVITMTNYWRKVARKEENSKARLKAKADSISNDSKERPGSHDIINPQDDAIINNDPNFK
IAAKINEITENDLKNYPDLMRNMSTHSKTDYLKKLPNQKSFPANKVKLQYASANWIPLVT
DNAGNHIAIDLDPDVDGMVGQVIIFGRDYDTKYVVADNWGQFMSKFALDFEDPSNCKLDY
DPDLGQFNLVYLDQSGNVVDGGYLEVLTRRVKGERL
Download sequence
Identical sequences A0A099P5H3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]