SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099SG28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099SG28
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily Rubredoxin-like 3.2e-24
Family Rubredoxin 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099SG28
Sequence length 53
Comment (tr|A0A099SG28|A0A099SG28_9FIRM) Rubredoxin {ECO:0000256|PIRNR:PIRNR000071} KW=Complete proteome OX=1487923 OS=Desulfosporosinus sp. HMP52. GN=DP73_01390 OC=Desulfosporosinus.
Sequence
MKKYQCSICGYVYDPVLGDPDSGIAPGTSFEDIPEDWVCPTCGVGKEDFEPVD
Download sequence
Identical sequences A0A099SG28 A0A1G8L908
WP_034596910.1.33588 WP_034596910.1.43281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]