SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099UHG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099UHG5
Domain Number 1 Region: 3-159
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 1.44e-57
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099UHG5
Sequence length 165
Comment (tr|A0A099UHG5|A0A099UHG5_9HELI) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome OX=76936 OS=Helicobacter typhlonius. GN=BN2458_PEG0577 OC=Helicobacteraceae; Helicobacter.
Sequence
MDFVSVIMGSKSDWNVMSECIEVFKKFDVAYEVIISSAHRSPERTKSYIKDAQSRGAQVF
IGAAGMAAHLAGAIASQTCKPVIGVPLSGGALDGLDALLSTVQMPSSMPVATVSIGKAGA
INAAHLAMQILSLKNDELAGKLIEDRVMKAKKVELDSAEIEVRRG
Download sequence
Identical sequences A0A099UHG5
WP_034328201.1.66632 WP_034328201.1.68204 WP_034328201.1.86993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]