SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099VLA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099VLA6
Domain Number 1 Region: 8-115
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000654
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A099VLA6
Sequence length 125
Comment (tr|A0A099VLA6|A0A099VLA6_9HELI) Uncharacterized protein {ECO:0000313|EMBL:KGL32998.1} KW=Complete proteome OX=50960 OS=Helicobacter trogontum. GN=LS80_08100 OC=Helicobacteraceae; Helicobacter.
Sequence
MFVEHCEIKDILDLKLKQEVIDFLIKNNAGTPKNRELHINGRIYVFNNVLNFNPNSKYEN
VRDYIKNLKDILDNEIPFGRDGFGNIYLVDLDSCLVRFYEHESGNKIELLPFNSFVKLFR
MDDDI
Download sequence
Identical sequences A0A099VLA6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]