SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099VZR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099VZR8
Domain Number 1 Region: 15-139
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000209
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099VZR8
Sequence length 142
Comment (tr|A0A099VZR8|A0A099VZR8_9LIST) Uncharacterized protein {ECO:0000313|EMBL:KGL37663.1} KW=Complete proteome; Reference proteome OX=1552123 OS=Listeria booriae. GN=EP57_16695 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MQFKFVTNNPENSFYPLNLQDIEQVEKELGLTFPNELRQFYLEIGYGFFKGSEYQINRLM
DPESVRDFRLRIDDYEFYPDIEIFDEVEEDKLVFFEGDESTTILIGLGEGETSPIYLFDT
LIANSLKEFLEKIMEDDLYYMK
Download sequence
Identical sequences A0A099VZR8
WP_036088442.1.2793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]