SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099W395 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099W395
Domain Number 1 Region: 3-125
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.2e-19
Family AadK N-terminal domain-like 0.005
Further Details:      
 
Domain Number 2 Region: 140-268
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 4.16e-18
Family AadK C-terminal domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A099W395
Sequence length 271
Comment (tr|A0A099W395|A0A099W395_9LIST) Uncharacterized protein {ECO:0000313|EMBL:KGL40314.1} KW=Complete proteome; Reference proteome OX=1552123 OS=Listeria booriae. GN=EP57_10450 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MLNEMLACIIAWAESEARVRAVVLEGSLAKNEDVDDLSDLDVNIWFEGDLAFGRGTEWLA
DIGEVLIENPLDMMSPAGEIRTQLVIFKNGEKVDFSFWPVSLLEKPFPYYEKFEMLVDKD
NYVAKISKCVTENKKVALAKSEFERIVNEFWFELHYVAKFLKRGEVWFVQGIQAGIRENY
FLPLFEECARIEGVKTSFSGRKIEKWLPSVFVKRLPCLFAGYDVADGWQVMWEEIALFEE
VSFFVARNRDFDLPIAKIEGMKALLKQIQEA
Download sequence
Identical sequences A0A099W395
WP_036086425.1.2793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]