SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099WEA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099WEA1
Domain Number 1 Region: 2-128
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.57e-24
Family SMI1/KNR4-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099WEA1
Sequence length 130
Comment (tr|A0A099WEA1|A0A099WEA1_9LIST) Uncharacterized protein {ECO:0000313|EMBL:KGL42853.1} KW=Complete proteome; Reference proteome OX=1552123 OS=Listeria booriae. GN=EP57_05185 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MKKYADLSITCKTGVSPQDLVDAEQLLGVQLDSQYKALVQLVNAPEFGEWLFYPVKDKRN
LRKTFDDIVRNTKIAREFGLPEAFVVIAEDGTGDFLCMMSGQPQVYYQNHEQDSAEVIAN
DLKAFIERVA
Download sequence
Identical sequences A0A099WEA1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]