SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099YX35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099YX35
Domain Number 1 Region: 142-187
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000981
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 2 Region: 40-112
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000184
Family Fibronectin type I module 0.016
Further Details:      
 
Domain Number 3 Region: 1-52
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000502
Family Growth factor receptor domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099YX35
Sequence length 294
Comment (tr|A0A099YX35|A0A099YX35_TINGU) Connective tissue growth factor {ECO:0000313|EMBL:KGL74779.1} KW=Complete proteome; Reference proteome OX=94827 OS=Tinamus guttatus (White-throated tinamou). GN=N309_06720 OC=Coelurosauria; Aves; Palaeognathae; Tinamiformes; Tinamidae; Tinamus.
Sequence
CCRVCAKQLGELCTERDPCDHHKGLFCDFGSPANRRIGVCTARDGAPCVFGGMVYRSGES
FQRSCKYQCTCLDGAVGCVPLCSMDVRLPSPDCPYPRRVKLPGKCCEEWVCDEAKEQTAV
GPALAAYRLEDTYGPDPTMMRANCLVQTTEWSACSKTCGMGISTRVTNDNAFCRLEKQSR
LCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSVKTYRAKFCGVCTDGRCCTP
HKTATLPVEFKCPDGEIMKRRMMFIKTCVCHYNCPGDNDIFESLYYRKMYGDMA
Download sequence
Identical sequences A0A099YX35

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]