SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099Z217 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099Z217
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.92e-63
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.00000201
Further Details:      
 
Domain Number 2 Region: 197-339
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.04e-57
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A099Z217
Sequence length 341
Comment (tr|A0A099Z217|A0A099Z217_TINGU) 2'-5'-oligoadenylate synthase 3 {ECO:0000313|EMBL:KGL76474.1} KW=Complete proteome; Reference proteome OX=94827 OS=Tinamus guttatus (White-throated tinamou). GN=N309_12060 OC=Coelurosauria; Aves; Palaeognathae; Tinamiformes; Tinamidae; Tinamus.
Sequence
MELYNTPSWQLDKFIQEELQPDSAFLEQLSVAVHTICEFLRETCFTGMPPPRTRVLKVIK
GGSAGKGTALRNSSDADLVMFLSCFKNYEDQEKNRAEIIREIQRRLLQCQQQERFEVEFE
VNRWPNPRVLSFQLRSKRLPESVDFDVLPAYDALHHVVRDYKTDPMVYIRLFEQCTQGGE
FSTCFTELQRDFISKRPTKVKSLIRLVKHWYKKLMLCHGETLPPQYALELLTVYAWEQGS
GETKFSMAEAFRTVLDLLQHYEHLCIYWTINYDFEDITLSYYLSRQLRKSRPVILDPADP
TNAVGAGSRWDLVAAEAKICCTQWCCLDVHGRPVQPWDVLV
Download sequence
Identical sequences A0A099Z217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]