SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099Z551 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099Z551
Domain Number 1 Region: 133-278,332-396
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.14e-31
Family Hemopexin-like domain 0.0025
Further Details:      
 
Domain Number 2 Region: 43-84
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000589
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 2-41
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000131
Family Somatomedin B domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A099Z551
Sequence length 397
Comment (tr|A0A099Z551|A0A099Z551_TINGU) Proteoglycan 4 {ECO:0000313|EMBL:KGL77604.1} KW=Complete proteome; Reference proteome OX=94827 OS=Tinamus guttatus (White-throated tinamou). GN=N309_03144 OC=Coelurosauria; Aves; Palaeognathae; Tinamiformes; Tinamidae; Tinamus.
Sequence
DLSSCTGRCGEGFSRERACQCDYSCQRFKECCPDFGKVCAPALSCSGRCFEAFERGRACD
CDADCERYGKCCPDYAKHCKEDQKASTTAKTDRTPVSKEIASKKETTTVKKEVTITTDKE
TTTLIKANIKEEKNLCNGKPADSVVALQNGTLAVFRGHYYFSWLGNGRGPPTTEPRRIVD
GWGVPSPIDTVFSRCNCDGKTFFIKGALYWRFTNGVMDAGYPKPLARGFAGLGGKIIAAL
PVARHHNRPESVYFIKKGGRIQQYIYKQEPVKACRNKPQVAIKYPAYVPTLVIRRRFQRA
VRLQAFHTVRINPQPAGNCLLLAEVLRKEVKITSYWRGLPKIIHSTLSVPNYNKPDGYDY
YAFSNNQYYSLDVASKIATSVTYLTGKTVSKDWYNCP
Download sequence
Identical sequences A0A099Z551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]