SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A099Z717 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A099Z717
Domain Number 1 Region: 131-201
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 1.44e-29
Family AN1-like Zinc finger 0.0000853
Further Details:      
 
Domain Number 2 Region: 13-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000328
Family A20-like zinc finger 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A099Z717
Sequence length 206
Comment (tr|A0A099Z717|A0A099Z717_TINGU) AN1-type zinc finger protein 5 {ECO:0000313|EMBL:KGL76863.1} KW=Complete proteome; Reference proteome OX=94827 OS=Tinamus guttatus (White-throated tinamou). GN=N309_15061 OC=Coelurosauria; Aves; Palaeognathae; Tinamiformes; Tinamidae; Tinamus.
Sequence
MAQETNQTQVPLLCTTGCGFYGSPRTNGMCSVCYKEFLQRRQSSDRISPPANGPNNSPVA
SSSAAEPCAEGDSALEDVKASAQTPVTHQMTAMSISREESSNETERFAKTEEASSASSSS
GTLLEIPKNAAEDKMVSEKVKQKKNRCFTCRKKIGLTGFDCRCGNLFCALHRYSDMHGCP
YDYKAEAAEKIRKENPIIVAEKIQKL
Download sequence
Identical sequences A0A099Z717
XP_010212364.1.20684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]